| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187437] (4 PDB entries) |
| Domain d2b1lb_: 2b1l B: [162966] automated match to d1z5ye1 mutant |
PDB Entry: 2b1l (more details), 1.9 Å
SCOPe Domain Sequences for d2b1lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1lb_ c.47.1.10 (B:) automated matches {Escherichia coli [TaxId: 562]}
mqfyqadvltqgkpvllnvwatwcptcraehqylnqlsaqgirvvgmnykddrqkaiswl
kelgnpyalslfdgdgmlgldlgvygapetflidgngiiryrhagdlnprvweeeikplw
ekyskeaaq
Timeline for d2b1lb_: