SCOPe 2.04: Domain d2b05e_: 2b05 E:

Lineage for d2b05e_ (2b05 E:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244
5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
6. Protein automated matches [190238] (5 species)
   not a true protein
7. Species Human (Homo sapiens) [TaxId:9606] [187008] (38 PDB entries)

8. Domain d2b05e_: 2b05 E: [162959]
   automated match to d1qjaa_

Details for d2b05e_

PDB Entry: 2b05, 2.55 Å

PDB Description: Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide

PDB Compounds: (E:) 14-3-3 protein gamma

SCOPe Domain Sequences for d2b05e_:

Sequence; same for both SEQRES and ATOM records:

>d2b05e_ a.118.7.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
reqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswrvi
ssieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskvfy
lkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysvfy
yeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt

Timeline for d2b05e_:

• d2b05e_ first appeared in SCOPe 2.01
  
• d2b05e_ appears in SCOPe 2.03
  
• d2b05e_ appears in SCOPe 2.05
  
• d2b05e_ appears in the current release, SCOPe 2.08