Lineage for d2b05e_ (2b05 E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922384Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 922385Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 922429Protein automated matches [190238] (4 species)
    not a true protein
  7. 922435Species Human (Homo sapiens) [TaxId:9606] [187008] (22 PDB entries)
  8. 922462Domain d2b05e_: 2b05 E: [162959]
    automated match to d1qjaa_

Details for d2b05e_

PDB Entry: 2b05 (more details), 2.55 Å

PDB Description: Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
PDB Compounds: (E:) 14-3-3 protein gamma

SCOPe Domain Sequences for d2b05e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b05e_ a.118.7.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
reqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswrvi
ssieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskvfy
lkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysvfy
yeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d2b05e_:

Click to download the PDB-style file with coordinates for d2b05e_.
(The format of our PDB-style files is described here.)

Timeline for d2b05e_: