SCOPe 2.06: Domain d2af0a1: 2af0 A:71-203

Lineage for d2af0a1 (2af0 A:71-203)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)

8. Domain d2af0a1: 2af0 A:71-203 [162776]
   Other proteins in same PDB: d2af0a2
   automated match to d2jm5a1

Details for d2af0a1

PDB Entry: 2af0, 2.3 Å

PDB Description: Structure of the Regulator of G-Protein Signaling Domain of RGS2

PDB Compounds: (A:) Regulator of G-protein signaling 2

SCOPe Domain Sequences for d2af0a1:

Sequence; same for both SEQRES and ATOM records:

>d2af0a1 a.91.1.0 (A:71-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspqklss
karkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsyprfl
esefyqdlckkpq

Timeline for d2af0a1:

• d2af0a1 first appeared in SCOPe 2.01, called d2af0a_
  
• d2af0a1 was called d2af0a_ in SCOPe 2.05
  
• d2af0a1 appears in SCOPe 2.07
  
• d2af0a1 appears in the current release, SCOPe 2.08