![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
![]() | Protein automated matches [190464] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries) |
![]() | Domain d2af0a_: 2af0 A: [162776] automated match to d2jm5a1 |
PDB Entry: 2af0 (more details), 2.3 Å
SCOPe Domain Sequences for d2af0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2af0a_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} adlgtenlyfqsmkpspeeaqlwseafdellaskyglaafraflksefceeniefwlace dfkktkspqklsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrv yslmennsyprflesefyqdlckkpq
Timeline for d2af0a_: