Lineage for d2af0a1 (2af0 A:71-203)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719852Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2719853Protein automated matches [190464] (3 species)
    not a true protein
  7. 2719862Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2719872Domain d2af0a1: 2af0 A:71-203 [162776]
    Other proteins in same PDB: d2af0a2
    automated match to d2jm5a1

Details for d2af0a1

PDB Entry: 2af0 (more details), 2.3 Å

PDB Description: Structure of the Regulator of G-Protein Signaling Domain of RGS2
PDB Compounds: (A:) Regulator of G-protein signaling 2

SCOPe Domain Sequences for d2af0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2af0a1 a.91.1.0 (A:71-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspqklss
karkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsyprfl
esefyqdlckkpq

SCOPe Domain Coordinates for d2af0a1:

Click to download the PDB-style file with coordinates for d2af0a1.
(The format of our PDB-style files is described here.)

Timeline for d2af0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2af0a2