Lineage for d2a5kb_ (2a5k B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797364Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
    contains an extra alpha-helical domain
  7. 2797397Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries)
  8. 2797454Domain d2a5kb_: 2a5k B: [162695]
    automated match to d1uj1b_
    complexed with azp

    has additional subdomain(s) that are not in the common domain

Details for d2a5kb_

PDB Entry: 2a5k (more details), 2.3 Å

PDB Description: Crystal structures of SARS coronavirus main peptidase inhibited by an aza-peptide epoxide in space group P212121
PDB Compounds: (B:) 3C-like peptidase

SCOPe Domain Sequences for d2a5kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5kb_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc

SCOPe Domain Coordinates for d2a5kb_:

Click to download the PDB-style file with coordinates for d2a5kb_.
(The format of our PDB-style files is described here.)

Timeline for d2a5kb_: