SCOPe 2.07: Domain d1zxta1: 1zxt A:5-71

Lineage for d1zxta1 (1zxt A:5-71)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.0: automated matches [191483] (1 protein)
   not a true family

6. Protein automated matches [190775] (3 species)
   not a true protein

7. Species Human herpesvirus 8 [TaxId:37296] [188205] (1 PDB entry)

8. Domain d1zxta1: 1zxt A:5-71 [162623]
   Other proteins in same PDB: d1zxta2, d1zxtb2, d1zxtc2, d1zxtd2
   automated match to d1hhva_

Details for d1zxta1

PDB Entry: 1zxt, 1.7 Å

PDB Description: Crystal Structure of A Viral Chemokine

PDB Compounds: (A:) functional macrophage inflammatory protein 1-alpha homolog

SCOPe Domain Sequences for d1zxta1:

Sequence; same for both SEQRES and ATOM records:

>d1zxta1 d.9.1.0 (A:5-71) automated matches {Human herpesvirus 8 [TaxId: 37296]}
vsytpnsccygfqqhpppvqilkewyptspacpkpgvilltkrgrqicadpsknwvrqlm
qrlpaia

Timeline for d1zxta1:

• d1zxta1 first appeared in SCOPe 2.01, called d1zxta_
  
• d1zxta1 appears in SCOPe 2.06
  
• d1zxta1 appears in the current release, SCOPe 2.08