Lineage for d1zxta1 (1zxt A:5-71)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2929386Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2929387Protein automated matches [190775] (3 species)
    not a true protein
  7. 2929425Species Human herpesvirus 8 [TaxId:37296] [188205] (1 PDB entry)
  8. 2929426Domain d1zxta1: 1zxt A:5-71 [162623]
    Other proteins in same PDB: d1zxta2, d1zxtb2, d1zxtc2, d1zxtd2
    automated match to d1hhva_

Details for d1zxta1

PDB Entry: 1zxt (more details), 1.7 Å

PDB Description: Crystal Structure of A Viral Chemokine
PDB Compounds: (A:) functional macrophage inflammatory protein 1-alpha homolog

SCOPe Domain Sequences for d1zxta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxta1 d.9.1.0 (A:5-71) automated matches {Human herpesvirus 8 [TaxId: 37296]}
vsytpnsccygfqqhpppvqilkewyptspacpkpgvilltkrgrqicadpsknwvrqlm
qrlpaia

SCOPe Domain Coordinates for d1zxta1:

Click to download the PDB-style file with coordinates for d1zxta1.
(The format of our PDB-style files is described here.)

Timeline for d1zxta1: