![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
![]() | Protein automated matches [190775] (3 species) not a true protein |
![]() | Species Human herpesvirus 8 [TaxId:37296] [188205] (1 PDB entry) |
![]() | Domain d1zxta1: 1zxt A:5-71 [162623] Other proteins in same PDB: d1zxta2, d1zxtb2, d1zxtc2, d1zxtd2 automated match to d1hhva_ |
PDB Entry: 1zxt (more details), 1.7 Å
SCOPe Domain Sequences for d1zxta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxta1 d.9.1.0 (A:5-71) automated matches {Human herpesvirus 8 [TaxId: 37296]} vsytpnsccygfqqhpppvqilkewyptspacpkpgvilltkrgrqicadpsknwvrqlm qrlpaia
Timeline for d1zxta1: