SCOP 1.73: Domain d1e3ha1: 1e3h A:263-345

Lineage for d1e3ha1 (1e3h A:263-345)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family)

5. Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein)

6. Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species)
   links two duplicated two-domain units formed by domains 1-2 and 4-5

7. Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries)

8. Domain d1e3ha1: 1e3h A:263-345 [16257]
   Other proteins in same PDB: d1e3ha2, d1e3ha3, d1e3ha4, d1e3ha5, d1e3ha6
   complexed with so4

Details for d1e3ha1

PDB Entry: 1e3h, 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme

PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOP Domain Sequences for d1e3ha1:

Sequence; same for both SEQRES and ATOM records:

>d1e3ha1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus [TaxId: 1890]}
yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr
altkslvrerviaekkridgrgv

Timeline for d1e3ha1:

• d1e3ha1 first appeared (with stable ids) in SCOP 1.55
  
• d1e3ha1 appears in SCOP 1.71
  
• d1e3ha1 appears in SCOP 1.75
  
• d1e3ha1 appears in the current release, SCOPe 2.08