![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family) ![]() |
![]() | Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein) |
![]() | Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species) links two duplicated two-domain units formed by domains 1-2 and 4-5 |
![]() | Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries) |
![]() | Domain d1e3ha1: 1e3h A:263-345 [16257] Other proteins in same PDB: d1e3ha2, d1e3ha3, d1e3ha4, d1e3ha5, d1e3ha6 complexed with so4 |
PDB Entry: 1e3h (more details), 2.6 Å
SCOPe Domain Sequences for d1e3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ha1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus [TaxId: 1890]} yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr altkslvrerviaekkridgrgv
Timeline for d1e3ha1: