Lineage for d1e3ha1 (1e3h A:263-345)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695614Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family) (S)
  5. 2695615Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein)
  6. 2695616Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (2 species)
    links two duplicated two-domain units formed by domains 1-2 and 4-5
  7. 2695619Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries)
  8. 2695621Domain d1e3ha1: 1e3h A:263-345 [16257]
    Other proteins in same PDB: d1e3ha2, d1e3ha3, d1e3ha4, d1e3ha5, d1e3ha6
    complexed with so4

Details for d1e3ha1

PDB Entry: 1e3h (more details), 2.6 Å

PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) guanosine pentaphosphate synthetase

SCOPe Domain Sequences for d1e3ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ha1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus [TaxId: 1890]}
yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr
altkslvrerviaekkridgrgv

SCOPe Domain Coordinates for d1e3ha1:

Click to download the PDB-style file with coordinates for d1e3ha1.
(The format of our PDB-style files is described here.)

Timeline for d1e3ha1: