Lineage for d1e3ha1 (1e3h A:263-345)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.9: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 [46915] (1 family) 
Family a.4.9.1: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 [46916] (1 protein) Protein Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 [46917] (1 species) Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries) 
Domain d1e3ha1: 1e3h A:263-345 [16257]
Other proteins in same PDB: d1e3ha2, d1e3ha3, d1e3ha4, d1e3ha5, d1e3ha6
Details for d1e3ha1
PDB Entry: 1e3h (more details), 2.6 Å
PDB Description: semet derivative of streptomyces antibioticus pnpase/gpsi enzyme
SCOP Domain Sequences for d1e3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ha1 a.4.9.1 (A:263-345) Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus}
yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr
altkslvrerviaekkridgrgv
SCOP Domain Coordinates for d1e3ha1:
Click to download the PDB-style file with coordinates for d1e3ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e3ha1:
- d1e3ha1 appears in SCOP 1.57
- d1e3ha1 appears in the current release, SCOPe 2.08
View in 3D
