SCOPe 2.07: Domain d1zkoa1: 1zko A:1-123

Lineage for d1zkoa1 (1zko A:1-123)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Protein H of glycine cleavage system [51236] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [188189] (1 PDB entry)

8. Domain d1zkoa1: 1zko A:1-123 [162500]
   Other proteins in same PDB: d1zkoa2, d1zkob2
   automated match to d1onla_
   complexed with na

Details for d1zkoa1

PDB Entry: 1zko, 1.65 Å

PDB Description: Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d1zkoa1:

Sequence; same for both SEQRES and ATOM records:

>d1zkoa1 b.84.1.1 (A:1-123) Protein H of glycine cleavage system {Thermotoga maritima [TaxId: 2336]}
lkmkkytkthewvsiedkvatvgitnhaqeqlgdvvyvdlpevgrevkkgevvasiesvk
aaadvyaplsgkivevnekldtepelinkdpegegwlfkmeisdegeledlldeqayqef
caq

Timeline for d1zkoa1:

• d1zkoa1 first appeared in SCOPe 2.01, called d1zkoa_
  
• d1zkoa1 appears in SCOPe 2.06
  
• d1zkoa1 appears in the current release, SCOPe 2.08