Class b: All beta proteins [48724] (178 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
Protein Protein H of glycine cleavage system [51236] (4 species) |
Species Thermotoga maritima [TaxId:2336] [188189] (1 PDB entry) |
Domain d1zkoa1: 1zko A:1-123 [162500] Other proteins in same PDB: d1zkoa2, d1zkob2 automated match to d1onla_ complexed with na |
PDB Entry: 1zko (more details), 1.65 Å
SCOPe Domain Sequences for d1zkoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkoa1 b.84.1.1 (A:1-123) Protein H of glycine cleavage system {Thermotoga maritima [TaxId: 2336]} lkmkkytkthewvsiedkvatvgitnhaqeqlgdvvyvdlpevgrevkkgevvasiesvk aaadvyaplsgkivevnekldtepelinkdpegegwlfkmeisdegeledlldeqayqef caq
Timeline for d1zkoa1: