Lineage for d1zkoa1 (1zko A:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817438Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2817439Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2817484Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 2817502Species Thermotoga maritima [TaxId:2336] [188189] (1 PDB entry)
  8. 2817503Domain d1zkoa1: 1zko A:1-123 [162500]
    Other proteins in same PDB: d1zkoa2, d1zkob2
    automated match to d1onla_
    complexed with na

Details for d1zkoa1

PDB Entry: 1zko (more details), 1.65 Å

PDB Description: Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d1zkoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkoa1 b.84.1.1 (A:1-123) Protein H of glycine cleavage system {Thermotoga maritima [TaxId: 2336]}
lkmkkytkthewvsiedkvatvgitnhaqeqlgdvvyvdlpevgrevkkgevvasiesvk
aaadvyaplsgkivevnekldtepelinkdpegegwlfkmeisdegeledlldeqayqef
caq

SCOPe Domain Coordinates for d1zkoa1:

Click to download the PDB-style file with coordinates for d1zkoa1.
(The format of our PDB-style files is described here.)

Timeline for d1zkoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zkoa2