SCOPe 2.01: Domain d1zkoa_: 1zko A:

Lineage for d1zkoa_ (1zko A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Protein H of glycine cleavage system [51236] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [188189] (1 PDB entry)

8. Domain d1zkoa_: 1zko A: [162500]
   automated match to d1onla_
   complexed with na

Details for d1zkoa_

PDB Entry: 1zko, 1.65 Å

PDB Description: Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution

PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d1zkoa_:

Sequence; same for both SEQRES and ATOM records:

>d1zkoa_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermotoga maritima [TaxId: 2336]}
hhhhhlkmkkytkthewvsiedkvatvgitnhaqeqlgdvvyvdlpevgrevkkgevvas
iesvkaaadvyaplsgkivevnekldtepelinkdpegegwlfkmeisdegeledlldeq
ayqefcaq

Timeline for d1zkoa_:

• d1zkoa_ is new in SCOPe 2.01-stable
  
• d1zkoa_ appears in SCOPe 2.02
  
• d1zkoa_ appears in the current release, SCOPe 2.08, called d1zkoa1