Lineage for d1zkoa_ (1zko A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1139355Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1139356Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1139357Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 1139398Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 1139414Species Thermotoga maritima [TaxId:2336] [188189] (1 PDB entry)
  8. 1139415Domain d1zkoa_: 1zko A: [162500]
    automated match to d1onla_
    complexed with na

Details for d1zkoa_

PDB Entry: 1zko (more details), 1.65 Å

PDB Description: Crystal structure of Glycine cleavage system H protein (tm0212) from Thermotoga maritima at 1.65 A resolution
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d1zkoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkoa_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermotoga maritima [TaxId: 2336]}
hhhhhlkmkkytkthewvsiedkvatvgitnhaqeqlgdvvyvdlpevgrevkkgevvas
iesvkaaadvyaplsgkivevnekldtepelinkdpegegwlfkmeisdegeledlldeq
ayqefcaq

SCOPe Domain Coordinates for d1zkoa_:

Click to download the PDB-style file with coordinates for d1zkoa_.
(The format of our PDB-style files is described here.)

Timeline for d1zkoa_: