Lineage for d1fc3c_ (1fc3 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723285Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1723360Family a.4.6.3: Spo0A [46903] (1 protein)
    elaborated with additional helices
    automatically mapped to Pfam PF08769
  6. 1723361Protein Spo0A [46904] (2 species)
  7. 1723362Species Bacillus stearothermophilus [TaxId:1422] [46905] (1 PDB entry)
  8. 1723365Domain d1fc3c_: 1fc3 C: [16239]
    CASP4

Details for d1fc3c_

PDB Entry: 1fc3 (more details), 2 Å

PDB Description: the crystal structure of trans-activation domain of the sporulation response regulator, spo0a
PDB Compounds: (C:) spo0a

SCOPe Domain Sequences for d1fc3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fc3c_ a.4.6.3 (C:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
nkpknldasitsiiheigvpahikgylylreaiamvyhdiellgsitkvlypdiakkynt
tasrverairhaievawsrgnlesisslfgytvsvskakptnsefiamvadklrle

SCOPe Domain Coordinates for d1fc3c_:

Click to download the PDB-style file with coordinates for d1fc3c_.
(The format of our PDB-style files is described here.)

Timeline for d1fc3c_: