![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.3: Spo0A [46903] (1 protein) elaborated with additional helices automatically mapped to Pfam PF08769 |
![]() | Protein Spo0A [46904] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [46905] (1 PDB entry) |
![]() | Domain d1fc3c_: 1fc3 C: [16239] CASP4 |
PDB Entry: 1fc3 (more details), 2 Å
SCOPe Domain Sequences for d1fc3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fc3c_ a.4.6.3 (C:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]} nkpknldasitsiiheigvpahikgylylreaiamvyhdiellgsitkvlypdiakkynt tasrverairhaievawsrgnlesisslfgytvsvskakptnsefiamvadklrle
Timeline for d1fc3c_: