SCOPe 2.05: Domain d1fc3b_: 1fc3 B:

Lineage for d1fc3b_ (1fc3 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.3: Spo0A [46903] (1 protein)
   elaborated with additional helices
   automatically mapped to Pfam PF08769

6. Protein Spo0A [46904] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [46905] (1 PDB entry)

8. Domain d1fc3b_: 1fc3 B: [16238]
   CASP4

Details for d1fc3b_

PDB Entry: 1fc3, 2 Å

PDB Description: the crystal structure of trans-activation domain of the sporulation response regulator, spo0a

PDB Compounds: (B:) spo0a

SCOPe Domain Sequences for d1fc3b_:

Sequence, based on SEQRES records:

>d1fc3b_ a.4.6.3 (B:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
kpknldasitsiiheigvpahikgylylreaiamvyhdiellgsitkvlypdiakkyntt
asrverairhaievawsrgnlesisslfgytvsvskakptnsefiamvadklrle

Sequence, based on observed residues (ATOM records):

>d1fc3b_ a.4.6.3 (B:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
kpknldasitsiiheigvpahikgylylreaiamvyhdiellgsitkvlypdiakkyntt
asrverairhaievawsrgnlkakptnsefiamvadklrle

Timeline for d1fc3b_:

• d1fc3b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fc3b_ appears in SCOPe 2.04
  
• d1fc3b_ appears in SCOPe 2.06
  
• d1fc3b_ appears in the current release, SCOPe 2.08