SCOPe 2.02: Domain d1z35a_: 1z35 A:

Lineage for d1z35a_ (1z35 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (15 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [187838] (9 PDB entries)

8. Domain d1z35a_: 1z35 A: [162365]
   automated match to d1a69a_
   complexed with 2fa

Details for d1z35a_

PDB Entry: 1z35, 2.5 Å

PDB Description: Crystal structure of Trichomonas vaginalis purine nucleoside phosphorylase complexed with 2-fluoroadenosine

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1z35a_:

Sequence, based on SEQRES records:

>d1z35a_ c.56.2.1 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm
ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf
mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem
esaglfpiadlygaragcictvsdhilhheettaeerqnsfqnmmkialeaaikl

Sequence, based on observed residues (ATOM records):

>d1z35a_ c.56.2.1 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm
ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf
mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem
esaglfpiadlygaragcictvsdhilhheerqnsfqnmmkialeaaikl

Timeline for d1z35a_:

• d1z35a_ first appeared in SCOPe 2.01
  
• d1z35a_ appears in SCOPe 2.03
  
• d1z35a_ appears in the current release, SCOPe 2.08