![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.53: Resolvase-like [53040] (2 superfamilies) Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
![]() | Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) ![]() |
![]() | Family c.53.2.0: automated matches [191506] (1 protein) not a true family |
![]() | Protein automated matches [190830] (3 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [188136] (1 PDB entry) |
![]() | Domain d1ylka_: 1ylk A: [162237] automated match to d1g5ca_ complexed with scn, zn |
PDB Entry: 1ylk (more details), 2 Å
SCOPe Domain Sequences for d1ylka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ylka_ c.53.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp
Timeline for d1ylka_: