SCOPe 2.03: Domain d1ylka_: 1ylk A:

Lineage for d1ylka_ (1ylk A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [188136] (1 PDB entry)

8. Domain d1ylka_: 1ylk A: [162237]
   automated match to d1g5ca_
   complexed with scn, zn

Details for d1ylka_

PDB Entry: 1ylk, 2 Å

PDB Description: Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate

PDB Compounds: (A:) Hypothetical protein Rv1284/MT1322

SCOPe Domain Sequences for d1ylka_:

Sequence; same for both SEQRES and ATOM records:

>d1ylka_ c.53.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

Timeline for d1ylka_:

• d1ylka_ first appeared in SCOPe 2.01
  
• d1ylka_ appears in SCOPe 2.02
  
• d1ylka_ appears in SCOPe 2.04
  
• d1ylka_ appears in the current release, SCOPe 2.08, called d1ylka1