Lineage for d1ylka1 (1ylk A:2-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883196Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2883197Protein automated matches [190830] (15 species)
    not a true protein
  7. 2883256Species Mycobacterium tuberculosis [TaxId:83332] [188136] (1 PDB entry)
  8. 2883257Domain d1ylka1: 1ylk A:2-163 [162237]
    Other proteins in same PDB: d1ylka2, d1ylkb2, d1ylkc2, d1ylkd2
    automated match to d1g5ca_
    complexed with scn, zn

Details for d1ylka1

PDB Entry: 1ylk (more details), 2 Å

PDB Description: Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate
PDB Compounds: (A:) Hypothetical protein Rv1284/MT1322

SCOPe Domain Sequences for d1ylka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylka1 c.53.2.0 (A:2-163) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnagc
vvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesyp
davedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

SCOPe Domain Coordinates for d1ylka1:

Click to download the PDB-style file with coordinates for d1ylka1.
(The format of our PDB-style files is described here.)

Timeline for d1ylka1: