Lineage for d1ylkc_ (1ylk C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372129Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1372172Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 1372278Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 1372279Protein automated matches [190830] (3 species)
    not a true protein
  7. 1372305Species Mycobacterium tuberculosis [TaxId:83332] [188136] (1 PDB entry)
  8. 1372308Domain d1ylkc_: 1ylk C: [162239]
    automated match to d1g5ca_
    complexed with scn, zn

Details for d1ylkc_

PDB Entry: 1ylk (more details), 2 Å

PDB Description: Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate
PDB Compounds: (C:) Hypothetical protein Rv1284/MT1322

SCOPe Domain Sequences for d1ylkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylkc_ c.53.2.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gtvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnag
cvvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesy
pdavedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

SCOPe Domain Coordinates for d1ylkc_:

Click to download the PDB-style file with coordinates for d1ylkc_.
(The format of our PDB-style files is described here.)

Timeline for d1ylkc_: