Lineage for d1yj2a_ (1yj2 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199443Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (35 PDB entries)
  8. 1199460Domain d1yj2a_: 1yj2 A: [162213]
    automated match to d1qyoa_
    complexed with edo, mg

Details for d1yj2a_

PDB Entry: 1yj2 (more details), 1.5 Å

PDB Description: cyclized, non-dehydrated post-translational product for s65a y66s h148g gfp variant
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1yj2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj2a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fasgvqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynsgnvyitadkqkngikanfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d1yj2a_:

Click to download the PDB-style file with coordinates for d1yj2a_.
(The format of our PDB-style files is described here.)

Timeline for d1yj2a_: