Lineage for d1x3oa_ (1x3o A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266817Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1266818Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1266819Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1266875Protein automated matches [190286] (7 species)
    not a true protein
  7. 1266910Species Thermus thermophilus [TaxId:300852] [188109] (1 PDB entry)
  8. 1266911Domain d1x3oa_: 1x3o A: [162033]
    automated match to d1hy8a_

Details for d1x3oa_

PDB Entry: 1x3o (more details), 1.5 Å

PDB Description: Crystal structure of the acyl carrier protein from thermus thermophilus HB8
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d1x3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3oa_ a.28.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mteqeifekvkaviadklqvepekvtlearfiedlgadsldtvelimgledefgleisde
eaekirtvkdaveyikaklg

SCOPe Domain Coordinates for d1x3oa_:

Click to download the PDB-style file with coordinates for d1x3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1x3oa_: