![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein automated matches [190286] (7 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [188109] (1 PDB entry) |
![]() | Domain d1x3oa_: 1x3o A: [162033] automated match to d1hy8a_ |
PDB Entry: 1x3o (more details), 1.5 Å
SCOPe Domain Sequences for d1x3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x3oa_ a.28.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} mteqeifekvkaviadklqvepekvtlearfiedlgadsldtvelimgledefgleisde eaekirtvkdaveyikaklg
Timeline for d1x3oa_: