PDB entry 1x3o

View 1x3o on RCSB PDB site
Description: Crystal structure of the acyl carrier protein from thermus thermophilus HB8
Class: lipid transport
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, LIPID TRANSPORT
Deposited on 2005-05-10, released 2006-05-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.252
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1x3oa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x3oA (A:)
    mteqeifekvkaviadklqvepekvtlearfiedlgadsldtvelimgledefgleisde
    eaekirtvkdaveyikaklg