Lineage for d1x3oa_ (1x3o A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706187Protein automated matches [190286] (9 species)
    not a true protein
  7. 2706224Species Thermus thermophilus HB8 [TaxId:300852] [188109] (1 PDB entry)
  8. 2706225Domain d1x3oa_: 1x3o A: [162033]
    automated match to d1hy8a_

Details for d1x3oa_

PDB Entry: 1x3o (more details), 1.5 Å

PDB Description: Crystal structure of the acyl carrier protein from thermus thermophilus HB8
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d1x3oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3oa_ a.28.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mteqeifekvkaviadklqvepekvtlearfiedlgadsldtvelimgledefgleisde
eaekirtvkdaveyikaklg

SCOPe Domain Coordinates for d1x3oa_:

Click to download the PDB-style file with coordinates for d1x3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1x3oa_: