SCOPe 2.04: Domain d1x3oa_: 1x3o A:

Lineage for d1x3oa_ (1x3o A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (8 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188109] (1 PDB entry)

8. Domain d1x3oa_: 1x3o A: [162033]
   automated match to d1hy8a_

Details for d1x3oa_

PDB Entry: 1x3o, 1.5 Å

PDB Description: Crystal structure of the acyl carrier protein from thermus thermophilus HB8

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d1x3oa_:

Sequence; same for both SEQRES and ATOM records:

>d1x3oa_ a.28.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mteqeifekvkaviadklqvepekvtlearfiedlgadsldtvelimgledefgleisde
eaekirtvkdaveyikaklg

Timeline for d1x3oa_:

• d1x3oa_ first appeared in SCOPe 2.01
  
• d1x3oa_ appears in SCOPe 2.03
  
• d1x3oa_ appears in SCOPe 2.05
  
• d1x3oa_ appears in the current release, SCOPe 2.08