SCOPe 2.02: Domain d1w7sc_: 1w7s C:

Lineage for d1w7sc_ (1w7s C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (35 PDB entries)

8. Domain d1w7sc_: 1w7s C: [161909]
   automated match to d1hcjc_

Details for d1w7sc_

PDB Entry: 1w7s, 1.85 Å

PDB Description: wild-type aequorea victoria green fluorescent protein

PDB Compounds: (C:) Green fluorescent protein

SCOPe Domain Sequences for d1w7sc_:

Sequence; same for both SEQRES and ATOM records:

>d1w7sc_ d.22.1.1 (C:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

Timeline for d1w7sc_:

• d1w7sc_ first appeared in SCOPe 2.01
  
• d1w7sc_ appears in SCOPe 2.03
  
• d1w7sc_ appears in the current release, SCOPe 2.08