SCOPe 2.08: Domain d1w45b_: 1w45 B:

Lineage for d1w45b_ (1w45 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.65: Annexin [47873] (1 superfamily)
   5 helices; folded leaf, closed

4. Superfamily a.65.1: Annexin [47874] (2 families)
   duplication: consists of four domains of the same fold

5. Family a.65.1.0: automated matches [191494] (1 protein)
   not a true family

6. Protein automated matches [190800] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188064] (6 PDB entries)

8. Domain d1w45b_: 1w45 B: [161890]
   automated match to d1anna_
   mutant

Details for d1w45b_

PDB Entry: 1w45, 2.51 Å

PDB Description: the 2.5 angstroem structure of the k16a mutant of annexin a8, which has an intact n-terminus.

PDB Compounds: (B:) annexin a8

SCOPe Domain Sequences for d1w45b_:

Sequence; same for both SEQRES and ATOM records:

>d1w45b_ a.65.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieqegvtvassshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqiaksfkaqf
gkdltetlkselsgkferlivalmyppyryeakelhdamkglgtkegviieilasrtknq
lreimkayeedygssleediqadtsgylerilvcllqgsrddvssfvdpalalqdaqdly
aagekirgtdemkfitilctrsathllrvfeeyekianksiedsiksethgsleeamltv
vkctqnlhsyfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmygktlssmi
medtsgdyknallslvgsdp

Timeline for d1w45b_:

• d1w45b_ first appeared in SCOPe 2.01
  
• d1w45b_ appears in SCOPe 2.07