Lineage for d1w45b_ (1w45 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 917779Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 917780Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 917887Family a.65.1.0: automated matches [191494] (1 protein)
    not a true family
  6. 917888Protein automated matches [190800] (1 species)
    not a true protein
  7. 917889Species Human (Homo sapiens) [TaxId:9606] [188064] (2 PDB entries)
  8. 917892Domain d1w45b_: 1w45 B: [161890]
    automated match to d1anna_
    mutant

Details for d1w45b_

PDB Entry: 1w45 (more details), 2.51 Å

PDB Description: the 2.5 angstroem structure of the k16a mutant of annexin a8, which has an intact n-terminus.
PDB Compounds: (B:) annexin a8

SCOPe Domain Sequences for d1w45b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w45b_ a.65.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ieqegvtvassshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqiaksfkaqf
gkdltetlkselsgkferlivalmyppyryeakelhdamkglgtkegviieilasrtknq
lreimkayeedygssleediqadtsgylerilvcllqgsrddvssfvdpalalqdaqdly
aagekirgtdemkfitilctrsathllrvfeeyekianksiedsiksethgsleeamltv
vkctqnlhsyfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmygktlssmi
medtsgdyknallslvgsdp

SCOPe Domain Coordinates for d1w45b_:

Click to download the PDB-style file with coordinates for d1w45b_.
(The format of our PDB-style files is described here.)

Timeline for d1w45b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w45a_