PDB entry 1w45

View 1w45 on RCSB PDB site
Description: The 2.5 Angstroem structure of the K16A mutant of annexin A8, which has an intact N-terminus.
Class: coagulation
Keywords: coagulation, annexin family, calcium and phospholipid binding proteins, intact n-terminus, cxalcium and membrane- binding protein
Deposited on 2004-07-22, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin a8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13928 (Start-326)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d1w45a_
  • Chain 'B':
    Compound: annexin a8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13928 (Start-326)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d1w45b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w45A (A:)
    mawwkawieqegvtvassshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqia
    ksfkaqfgkdltetlkselsgkferlivalmyppyryeakelhdamkglgtkegviieil
    asrtknqlreimkayeedygssleediqadtsgylerilvcllqgsrddvssfvdpalal
    qdaqdlyaagekirgtdemkfitilctrsathllrvfeeyekianksiedsiksethgsl
    eeamltvvkctqnlhsyfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmyg
    ktlssmimedtsgdyknallslvgsdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w45A (A:)
    ieqegvtvassshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqiaksfkaqf
    gkdltetlkselsgkferlivalmyppyryeakelhdamkglgtkegviieilasrtknq
    lreimkayeedygssleediqadtsgylerilvcllqgsrddvssfvdpalalqdaqdly
    aagekirgtdemkfitilctrsathllrvfeeyekianksiedsiksethgsleeamltv
    vkctqnlhsyfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmygktlssmi
    medtsgdyknallslvgsdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w45B (B:)
    mawwkawieqegvtvassshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqia
    ksfkaqfgkdltetlkselsgkferlivalmyppyryeakelhdamkglgtkegviieil
    asrtknqlreimkayeedygssleediqadtsgylerilvcllqgsrddvssfvdpalal
    qdaqdlyaagekirgtdemkfitilctrsathllrvfeeyekianksiedsiksethgsl
    eeamltvvkctqnlhsyfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmyg
    ktlssmimedtsgdyknallslvgsdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w45B (B:)
    ieqegvtvassshfnpdpdaetlykamkgigtneqaiidvltkrsntqrqqiaksfkaqf
    gkdltetlkselsgkferlivalmyppyryeakelhdamkglgtkegviieilasrtknq
    lreimkayeedygssleediqadtsgylerilvcllqgsrddvssfvdpalalqdaqdly
    aagekirgtdemkfitilctrsathllrvfeeyekianksiedsiksethgsleeamltv
    vkctqnlhsyfaerlyyamkgagtrdgtlirnivsrseidlnlikchfkkmygktlssmi
    medtsgdyknallslvgsdp