SCOPe 2.06: Domain d1veza_: 1vez A:

Lineage for d1veza_ (1vez A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Leptospira interrogans [TaxId:173] [103340] (5 PDB entries)
   Uniprot Q72S74

8. Domain d1veza_: 1vez A: [161854]
   automated match to d1y6ha_
   complexed with fmt, trs, zn

Details for d1veza_

PDB Entry: 1vez, 2.3 Å

PDB Description: Crystal Structure of Peptide Deformylase from Leptospira Interrogans(LiPDF) at pH8.0

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1veza_:

Sequence; same for both SEQRES and ATOM records:

>d1veza_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldss

Timeline for d1veza_:

• d1veza_ first appeared in SCOPe 2.01
  
• d1veza_ appears in SCOPe 2.05
  
• d1veza_ appears in SCOPe 2.07
  
• d1veza_ appears in the current release, SCOPe 2.08