Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein Peptide deformylase [56422] (11 species) |
Species Leptospira interrogans [TaxId:173] [103340] (5 PDB entries) Uniprot Q72S74 |
Domain d1veza_: 1vez A: [161854] automated match to d1y6ha_ complexed with fmt, trs, zn |
PDB Entry: 1vez (more details), 2.3 Å
SCOPe Domain Sequences for d1veza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veza_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldss
Timeline for d1veza_: