Lineage for d1veza_ (1vez A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047857Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 1047858Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 1047859Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
  6. 1047860Protein Peptide deformylase [56422] (10 species)
  7. 1047908Species Leptospira interrogans [TaxId:173] [103340] (3 PDB entries)
    Uniprot Q72S74
  8. 1047911Domain d1veza_: 1vez A: [161854]
    automated match to d1y6ha_
    complexed with fmt, trs, zn

Details for d1veza_

PDB Entry: 1vez (more details), 2.3 Å

PDB Description: Crystal Structure of Peptide Deformylase from Leptospira Interrogans(LiPDF) at pH8.0
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1veza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veza_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]}
svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi
vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq
wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldss

SCOPe Domain Coordinates for d1veza_:

Click to download the PDB-style file with coordinates for d1veza_.
(The format of our PDB-style files is described here.)

Timeline for d1veza_: