![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
![]() | Protein Peptide deformylase [56422] (11 species) |
![]() | Species Leptospira interrogans [TaxId:173] [103340] (5 PDB entries) Uniprot Q72S74 |
![]() | Domain d1y6ha_: 1y6h A: [116505] complexed with fmt, gly, zn |
PDB Entry: 1y6h (more details), 2.2 Å
SCOPe Domain Sequences for d1y6ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} svrkilrmgdpilrkisepvtedeiqtkefkklirdmfdtmrhaegvglaapqigilkqi vvvgsednerypgtpdvperiilnpvitpltkdtsgfwegclsvpgmrgyverpnqirmq wmdekgnqfdetidgykaivyqhecdhlqgilyvdrlkdtklfgfnetldsshnvld
Timeline for d1y6ha_: