![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.21: ets domain [46859] (9 proteins) |
![]() | Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries) |
![]() | Domain d1bc8c_: 1bc8 C: [16168] protein/DNA complex; complexed with zn |
PDB Entry: 1bc8 (more details), 1.93 Å
SCOPe Domain Sequences for d1bc8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bc8c_ a.4.5.21 (C:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls ralryyyvkniikkvngqkfvykfvsypeilnm
Timeline for d1bc8c_: