Lineage for d1bc8c_ (1bc8 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693461Protein Serum response factor accessory protein 1a, SAP-1 [46869] (1 species)
  7. 2693462Species Human (Homo sapiens) [TaxId:9606] [46870] (4 PDB entries)
  8. 2693463Domain d1bc8c_: 1bc8 C: [16168]
    protein/DNA complex; complexed with zn

Details for d1bc8c_

PDB Entry: 1bc8 (more details), 1.93 Å

PDB Description: structures of sap-1 bound to dna sequences from the e74 and c-fos promoters provide insights into how ets proteins discriminate between related dna targets
PDB Compounds: (C:) protein (sap-1 ets domain)

SCOPe Domain Sequences for d1bc8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bc8c_ a.4.5.21 (C:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]}
mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
ralryyyvkniikkvngqkfvykfvsypeilnm

SCOPe Domain Coordinates for d1bc8c_:

Click to download the PDB-style file with coordinates for d1bc8c_.
(The format of our PDB-style files is described here.)

Timeline for d1bc8c_: