PDB entry 1bc8

View 1bc8 on RCSB PDB site
Description: structures of sap-1 bound to DNA sequences from the e74 and c-fos promoters provide insights into how ets proteins discriminate between related DNA targets
Class: transcription/DNA
Keywords: ets domain, DNA-binding domain, winged helix-turn-helix, crystal structure, DNA-binding specificity, transcription/DNA complex
Deposited on 1998-05-05, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.22
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*tp*ap*cp*cp*gp*gp*ap*ap*gp*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*ap*ap*cp*tp*tp*cp*cp*gp*gp*t)-3')
  • Chain 'C':
    Compound: protein (sap-1 ets domain)
    Species: Homo sapiens [TaxId:9606]
    Gene: SAP-1 RESIDUES 1-93
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bc8c_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bc8C (C:)
mdsaitlwqfllqllqkpqnkhmicwtsndgqfkllqaeevarlwgirknkpnmnydkls
ralryyyvkniikkvngqkfvykfvsypeilnm