Lineage for d1puee_ (1pue E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693426Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2693468Protein Transcription factor PU.1, residues 171-259 [46865] (1 species)
  7. 2693469Species Mouse (Mus musculus) [TaxId:10090] [46866] (1 PDB entry)
  8. 2693470Domain d1puee_: 1pue E: [16165]
    protein/DNA complex

Details for d1puee_

PDB Entry: 1pue (more details), 2.1 Å

PDB Description: pu.1 ets domain-dna complex
PDB Compounds: (E:) protein (transcription factor pu.1 (tf pu.1))

SCOPe Domain Sequences for d1puee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]}
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgev

SCOPe Domain Coordinates for d1puee_:

Click to download the PDB-style file with coordinates for d1puee_.
(The format of our PDB-style files is described here.)

Timeline for d1puee_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1puef_