PDB entry 1pue
View 1pue on RCSB PDB site
Description: pu.1 ets domain-DNA complex
Class: transcription/DNA
Keywords: complex (transcription regulating-DNA), oncogene, transforming protein, DNA- binding, activator, nuclear protein, transcription-DNA complex
Deposited on
1996-07-08, released
1997-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-02-15, with a file datestamp of
2017-02-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: DNA (5'-d(*ap*ap*ap*ap*ap*gp*gp*gp*gp*ap*ap*gp*tp*gp*gp*g)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'B':
Compound: DNA (5'-d(*tp*cp*cp*cp*ap*cp*tp*tp*cp*cp*cp*cp*tp*tp*tp*t)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'C':
Compound: DNA (5'-d(*ap*ap*ap*ap*ap*gp*gp*gp*gp*ap*ap*gp*tp*gp*gp*g)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'D':
Compound: DNA (5'-d(*tp*cp*cp*cp*ap*cp*tp*tp*cp*cp*cp*cp*tp*tp*tp*t)-3')
Species: synthetic construct, synthetic [TaxId:32630]
- Chain 'E':
Compound: protein (transcription factor pu.1 (tf pu.1))
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1puee_ - Chain 'F':
Compound: protein (transcription factor pu.1 (tf pu.1))
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1puef_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence, based on SEQRES records: (download)
>1pueE (E:)
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgevl
Sequence, based on observed residues (ATOM records): (download)
>1pueE (E:)
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgev
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1pueF (F:)
kirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnrkkmtyekm
aralrnygktgevkkvkkkltyqfsgevl