| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.21: ets domain [46859] (6 proteins) |
| Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [46864] (3 PDB entries) |
| Domain d2stwa_: 2stw A: [16164] protein/DNA complex |
PDB Entry: 2stw (more details)
SCOP Domain Sequences for d2stwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2stwa_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens)}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv
Timeline for d2stwa_: