Lineage for d2stwa_ (2stw A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1583Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 1588Protein ETS-1 transcription factor, residues 331-440 [46862] (2 species)
  7. 1589Species Human (Homo sapiens) [TaxId:9606] [46864] (2 PDB entries)
  8. 1591Domain d2stwa_: 2stw A: [16164]

Details for d2stwa_

PDB Entry: 2stw (more details)

PDB Description: solution nmr structure of the human ets1/dna complex, restrained regularized mean structure

SCOP Domain Sequences for d2stwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2stwa_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens)}
vipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrk
nkpkmnyeklsrglryyydkniihktagkryvyrfv

SCOP Domain Coordinates for d2stwa_:

Click to download the PDB-style file with coordinates for d2stwa_.
(The format of our PDB-style files is described here.)

Timeline for d2stwa_: