Lineage for d2q4kc_ (2q4k C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569268Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2569269Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2569380Family d.86.1.2: BLES03-like [143583] (1 protein)
    the N-terminal strand is missing, but there extra C-terminal strands in the beta-sheet
    automatically mapped to Pfam PF08939
  6. 2569381Protein Basophilic leukemia expressed protein BLES03 [143584] (1 species)
  7. 2569382Species Human (Homo sapiens) [TaxId:9606] [143585] (2 PDB entries)
    Uniprot Q9H3H3 17-250
  8. 2569385Domain d2q4kc_: 2q4k C: [161522]
    automated match to d1ztpa1

Details for d2q4kc_

PDB Entry: 2q4k (more details), 2.5 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Homo sapiens Hs.433573
PDB Compounds: (C:) Uncharacterized protein C11orf68

SCOPe Domain Sequences for d2q4kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q4kc_ d.86.1.2 (C:) Basophilic leukemia expressed protein BLES03 {Human (Homo sapiens) [TaxId: 9606]}
maadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepvgwiavygqgyspn
sgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapgfkldhawagiara
vvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaagikclltykpdvyt
ylgiyranrwhlcptlyesrfqlggsargsrvldrannvel

SCOPe Domain Coordinates for d2q4kc_:

Click to download the PDB-style file with coordinates for d2q4kc_.
(The format of our PDB-style files is described here.)

Timeline for d2q4kc_: