![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
![]() | Superfamily d.86.1: eIF4e-like [55418] (3 families) ![]() |
![]() | Family d.86.1.2: BLES03-like [143583] (1 protein) the N-terminal strand is missing, but there extra C-terminal strands in the beta-sheet automatically mapped to Pfam PF08939 |
![]() | Protein Basophilic leukemia expressed protein BLES03 [143584] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143585] (2 PDB entries) Uniprot Q9H3H3 17-250 |
![]() | Domain d2q4kb_: 2q4k B: [139865] automated match to d1ztpa1 |
PDB Entry: 2q4k (more details), 2.5 Å
SCOPe Domain Sequences for d2q4kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q4kb_ d.86.1.2 (B:) Basophilic leukemia expressed protein BLES03 {Human (Homo sapiens) [TaxId: 9606]} edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag ikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsrvldrannvelt
Timeline for d2q4kb_: