PDB entry 2q4k

View 2q4k on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Homo sapiens Hs.433573
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, Hs.433573, P5326, BLES03, BC010512, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.166
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein C11orf68
    Species: Homo sapiens [TaxId:9606]
    Gene: C11orf68, BLES03, Hs.433573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3H3
      • modified residue (29)
      • modified residue (33)
      • modified residue (130)
    Domains in SCOPe 2.07: d2q4ka_
  • Chain 'B':
    Compound: Uncharacterized protein C11orf68
    Species: Homo sapiens [TaxId:9606]
    Gene: C11orf68, BLES03, Hs.433573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3H3 (Start-250)
      • modified residue (29)
      • modified residue (33)
      • modified residue (130)
    Domains in SCOPe 2.07: d2q4kb_
  • Chain 'C':
    Compound: Uncharacterized protein C11orf68
    Species: Homo sapiens [TaxId:9606]
    Gene: C11orf68, BLES03, Hs.433573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H3H3
      • modified residue (29)
      • modified residue (33)
      • modified residue (130)
    Domains in SCOPe 2.07: d2q4kc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4kA (A:)
    mepgeeleeegspggredgftaehlaaeamaadmdpwlvfdarttpateldawlakypps
    qvtrygdpgspnsepvgwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlai
    thhvlsgkwlmhlapgfkldhawagiaravvegrlqvakvsprakeggrqvicvytddft
    drlgvleadsairaagikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsr
    vldrannvelt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4kA (A:)
    edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
    gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
    fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
    ikclltykpdvytylgiyranrwhlcptlyesrfqgsrvldrannvel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4kB (B:)
    mepgeeleeegspggredgftaehlaaeamaadmdpwlvfdarttpateldawlakypps
    qvtrygdpgspnsepvgwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlai
    thhvlsgkwlmhlapgfkldhawagiaravvegrlqvakvsprakeggrqvicvytddft
    drlgvleadsairaagikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsr
    vldrannvelt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4kB (B:)
    edgftaehlaaeamaadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepv
    gwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapg
    fkldhawagiaravvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaag
    ikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsrvldrannvelt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q4kC (C:)
    mepgeeleeegspggredgftaehlaaeamaadmdpwlvfdarttpateldawlakypps
    qvtrygdpgspnsepvgwiavygqgyspnsgdvqglqaawealqtsgrpitpgtlrqlai
    thhvlsgkwlmhlapgfkldhawagiaravvegrlqvakvsprakeggrqvicvytddft
    drlgvleadsairaagikclltykpdvytylgiyranrwhlcptlyesrfqlggsargsr
    vldrannvelt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4kC (C:)
    maadmdpwlvfdarttpateldawlakyppsqvtrygdpgspnsepvgwiavygqgyspn
    sgdvqglqaawealqtsgrpitpgtlrqlaithhvlsgkwlmhlapgfkldhawagiara
    vvegrlqvakvsprakeggrqvicvytddftdrlgvleadsairaagikclltykpdvyt
    ylgiyranrwhlcptlyesrfqlggsargsrvldrannvel