Class a: All alpha proteins [46456] (289 folds) |
Fold a.287: TerB-like [158681] (1 superfamily) multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry |
Superfamily a.287.1: TerB-like [158682] (2 families) members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure |
Family a.287.1.2: PG1108-like [158686] (1 protein) automatically mapped to Pfam PF05099 |
Protein Hypothetical protein PG1108 [158687] (1 species) |
Species Porphyromonas gingivalis [TaxId:837] [158688] (1 PDB entry) Uniprot Q7MVF6 1-132 |
Domain d2h5nd_: 2h5n D: [161451] automated match to d2h5na1 complexed with mg |
PDB Entry: 2h5n (more details), 2.01 Å
SCOPe Domain Sequences for d2h5nd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h5nd_ a.287.1.2 (D:) Hypothetical protein PG1108 {Porphyromonas gingivalis [TaxId: 837]} mtfsgqeltaiikmaksmvmadgkikpaeiavmtrefmrfgilqdqvdlllkasdsieas qavaliarmdeerkkyvasylgvimasdgdiddnelalwtlistlcglptmtvmeainnm knl
Timeline for d2h5nd_: