SCOPe 2.07: Domain d2h5nc_: 2h5n C:

Lineage for d2h5nc_ (2h5n C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.287: TerB-like [158681] (1 superfamily)
   multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry

4. Superfamily a.287.1: TerB-like [158682] (2 families)
   members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure

5. Family a.287.1.2: PG1108-like [158686] (1 protein)
   automatically mapped to Pfam PF05099

6. Protein Hypothetical protein PG1108 [158687] (1 species)

7. Species Porphyromonas gingivalis [TaxId:837] [158688] (1 PDB entry)
   Uniprot Q7MVF6 1-132

8. Domain d2h5nc_: 2h5n C: [161450]
   automated match to d2h5na1
   complexed with mg

Details for d2h5nc_

PDB Entry: 2h5n, 2.01 Å

PDB Description: Crystal Structure of Protein of Unknown Function PG1108 from Porphyromonas gingivalis W83

PDB Compounds: (C:) Hypothetical protein PG_1108

SCOPe Domain Sequences for d2h5nc_:

Sequence; same for both SEQRES and ATOM records:

>d2h5nc_ a.287.1.2 (C:) Hypothetical protein PG1108 {Porphyromonas gingivalis [TaxId: 837]}
imtfsgqeltaiikmaksmvmadgkikpaeiavmtrefmrfgilqdqvdlllkasdsiea
sqavaliarmdeerkkyvasylgvimasdgdiddnelalwtlistlcglptmtvmeainn
mknl

Timeline for d2h5nc_:

• d2h5nc_ first appeared in SCOPe 2.01
  
• d2h5nc_ appears in SCOPe 2.06
  
• d2h5nc_ appears in the current release, SCOPe 2.08