Lineage for d2h5nd_ (2h5n D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 929189Fold a.287: TerB-like [158681] (1 superfamily)
    multihelical; contains two central helices; duplication: there are two three-helical repeats related by pseudo twofold symmetry
  4. 929190Superfamily a.287.1: TerB-like [158682] (2 families) (S)
    members of this superfamily probably related to the tellurite resistance protein TerB (Pfam PF05099) of yet undetermined structure
  5. 929196Family a.287.1.2: PG1108-like [158686] (1 protein)
  6. 929197Protein Hypothetical protein PG1108 [158687] (1 species)
  7. 929198Species Porphyromonas gingivalis [TaxId:837] [158688] (1 PDB entry)
    Uniprot Q7MVF6 1-132
  8. 929202Domain d2h5nd_: 2h5n D: [161451]
    automated match to d2h5na1
    complexed with mg

Details for d2h5nd_

PDB Entry: 2h5n (more details), 2.01 Å

PDB Description: Crystal Structure of Protein of Unknown Function PG1108 from Porphyromonas gingivalis W83
PDB Compounds: (D:) Hypothetical protein PG_1108

SCOPe Domain Sequences for d2h5nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5nd_ a.287.1.2 (D:) Hypothetical protein PG1108 {Porphyromonas gingivalis [TaxId: 837]}
mtfsgqeltaiikmaksmvmadgkikpaeiavmtrefmrfgilqdqvdlllkasdsieas
qavaliarmdeerkkyvasylgvimasdgdiddnelalwtlistlcglptmtvmeainnm
knl

SCOPe Domain Coordinates for d2h5nd_:

Click to download the PDB-style file with coordinates for d2h5nd_.
(The format of our PDB-style files is described here.)

Timeline for d2h5nd_: