Lineage for d2evse_ (2evs E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015647Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2015648Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2015649Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 protein domains)
  6. 2015650Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2015653Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 2015673Domain d2evse_: 2evs E: [161416]
    automated match to d1sx6a_
    complexed with d10, glc, hex

Details for d2evse_

PDB Entry: 2evs (more details), 2.2 Å

PDB Description: crystal structure of human glycolipid transfer protein complexed with n-hexyl-beta-d-glucoside
PDB Compounds: (E:) glycolipid transfer protein

SCOPe Domain Sequences for d2evse_:

Sequence, based on SEQRES records: (download)

>d2evse_ a.224.1.1 (E:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
ietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakfrtlqnileve
kemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvnatkayemalk
kyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvnytatidviyem
ytqmnaelnykv

Sequence, based on observed residues (ATOM records): (download)

>d2evse_ a.224.1.1 (E:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
ietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakfrtlqnileve
kemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvnatkayemalk
kyhgwivqkifqaalyaapyksdflkalsvteeeclekirlflvnytatidviyemytqm
naelnykv

SCOPe Domain Coordinates for d2evse_:

Click to download the PDB-style file with coordinates for d2evse_.
(The format of our PDB-style files is described here.)

Timeline for d2evse_: