PDB entry 2evs

View 2evs on RCSB PDB site
Description: Crystal structure of human Glycolipid Transfer Protein complexed with n-hexyl-beta-D-glucoside
Class: lipid transport
Keywords: Protein complex with detergent, LIPID TRANSPORT
Deposited on 2005-10-31, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2evsa_
  • Chain 'E':
    Compound: glycolipid transfer protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GLTP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2evse_
  • Heterogens: GLC, HEX, D10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2evsA (A:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2evsA (A:)
    aehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnp
    akfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnli
    rvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlfl
    vnytatidviyemytqmnaelnykv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2evsE (E:)
    mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki
    rlflvnytatidviyemytqmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2evsE (E:)
    ietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakfrtlqnileve
    kemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvnatkayemalk
    kyhgwivqkifqaalyaapyksdflkalsvteeeclekirlflvnytatidviyemytqm
    naelnykv